PDB entry 1x9n

View 1x9n on RCSB PDB site
Description: Crystal Structure of Human DNA Ligase I bound to 5'-adenylated, nicked DNA
Deposited on 2004-08-23, released 2004-11-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-30, with a file datestamp of 2004-11-30.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.236
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x9nA (A:)
    mtprkpavkkevkeeepgapgkegaaegpldpsgynpaknnyhpvedacwkpgqkvpyla
    vartfekieevsarlrmvetlsnllrsvvalsppdllpvlylslnhlgppqqglelgvgd
    gvllkavaqatgrqlesvraeaaekgdvglvaensrstqrlmlppppltasgvfskfrdi
    arltgsastakkidiikglfvacrhsearfiarslsgrlrlglaeqsvlaalsqavsltp
    pgqefppamvdagkgktaearktwleeqgmilkqtfcevpdldriipvllehglerlpeh
    cklspgiplkpmlahptrgisevlkrfeeaaftceykydgqraqihaleggevkifsrnq
    edntgkypdiisripkiklpsvtsfildteavawdrekkqiqpfqvlttrkrkevdasei
    qvqvclyafdliylngeslvreplsrrrqllrenfvetegefvfatsldtkdieqiaefl
    eqsvkdsceglmvktldvdatyeiakrshnwlklkkdyldgvgdtldlvvigaylgrgkr
    agryggfllasydedseelqaicklgtgfsdeeleehhqslkalvlpsprpyvridgavi
    pdhwldpsavwevkcadlslspiypaarglvdsdkgislrfprfirvredkqpeqattsa
    qvaclyrkqsqiqnqqgedsgsdpedty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9nA (A:)
    dpsgynpaknnyhpvedacwkpgqkvpylavartfekieevsarlrmvetlsnllrsvva
    lsppdllpvlylslnhlgppqqglelgvgdgvllkavaqatgrqlesvraeaaekgdvgl
    vaemlppppltasgvfskfrdiarltgsastakkidiikglfvacrhsearfiarslsgr
    lrlglaeqsvlaalsqavsltppgqefppamvdagkgktaearktwleeqgmilkqtfce
    vpdldriipvllehglerlpehcklspgiplkpmlahptrgisevlkrfeeaaftceyky
    dgqraqihaleggevkifsrnqedntgkypdiisripkiklpsvtsfildteavawdrek
    kqiqpfqvlttrkrkevdaseiqvqvclyafdliylngeslvreplsrrrqllrenfvet
    egefvfatsldtkdieqiaefleqsvkdsceglmvktldvdatyeiakrshnwlklkkdy
    ldgvgdtldlvvigaylgrgkragryggfllasydedseelqaicklgtgfsdeeleehh
    qslkalvlpsprpyvridgavipdhwldpsavwevkcadlslspiypaarglvdsdkgis
    lrfprfirvredkqpeqattsaqvaclyrkqs