PDB entry 1x9l

View 1x9l on RCSB PDB site
Description: Solution structure of CuI-DR1885 from Deinococcus Radiodurans
Class: metal binding protein
Keywords: copper binding protein, deinococcus radiodurans, solution structure, holo-form, Structural Proteomics in Europe, SPINE, Structural Genomics, METAL BINDING PROTEIN
Deposited on 2004-08-23, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CuI-DR1885
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RT80 (1-144)
      • initiating methionine (0)
      • cloning artifact (145-148)
    Domains in SCOPe 2.07: d1x9la1, d1x9la2
  • Heterogens: CU1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1x9lA (A:)
mghtmpahtppaqtapaaqkagaqalpvtvqgatvaavppsirdtaaymtltnksdqpik
lvgaatplatspmlmttthsggmagmkmvpwltipargtltlqrdgdhvmlmglkrplkv
getvnitlkatdgrtlnvaatvkkniegr