PDB entry 1x9j

View 1x9j on RCSB PDB site
Description: Structure of butyrate kinase 2 reveals both open- and citrate-induced closed conformations: implications for substrate-induced fit conformational changes
Class: transferase
Keywords: askha (acetate and sugar kinases, hsc70, actin) superfamily, butyrate kinase, acetate kinase, isobutyrate kinase, two similar domains, butyrate, isobutyrate, enzyme mechanism, transferase
Deposited on 2004-08-21, released 2005-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.261
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable butyrate kinase 2
    Species: Thermotoga maritima [TaxId:2336]
    Gene: buk2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x9ja1, d1x9ja2
  • Chain 'B':
    Compound: Probable butyrate kinase 2
    Species: Thermotoga maritima [TaxId:2336]
    Gene: buk2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x9jb1, d1x9jb2
  • Chain 'C':
    Compound: Probable butyrate kinase 2
    Species: Thermotoga maritima [TaxId:2336]
    Gene: buk2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x9jc1, d1x9jc2
  • Chain 'D':
    Compound: Probable butyrate kinase 2
    Species: Thermotoga maritima [TaxId:2336]
    Gene: buk2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x9jd1, d1x9jd2
  • Chain 'E':
    Compound: Probable butyrate kinase 2
    Species: Thermotoga maritima [TaxId:2336]
    Gene: buk2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x9je1, d1x9je2
  • Chain 'F':
    Compound: Probable butyrate kinase 2
    Species: Thermotoga maritima [TaxId:2336]
    Gene: buk2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x9jf1, d1x9jf2
  • Chain 'G':
    Compound: Probable butyrate kinase 2
    Species: Thermotoga maritima [TaxId:2336]
    Gene: buk2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x9jg1, d1x9jg2
  • Chain 'H':
    Compound: Probable butyrate kinase 2
    Species: Thermotoga maritima [TaxId:2336]
    Gene: buk2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x9jh1, d1x9jh2
  • Heterogens: NA, PO4, CIT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x9jA (A:)
    mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
    tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
    gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkryeemnlvv
    ahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkftyeemkkr
    ivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavlkgevdfiv
    ltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekpknyseesr
    rwrerydsyldgilr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9jA (A:)
    mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
    tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
    gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkryeemnlvv
    ahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkftyeemkkr
    ivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavlkgevdfiv
    ltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekpknyseesr
    rwrerydsyldgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x9jB (B:)
    mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
    tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
    gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkryeemnlvv
    ahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkftyeemkkr
    ivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavlkgevdfiv
    ltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekpknyseesr
    rwrerydsyldgilr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9jB (B:)
    mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
    tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
    gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkryeemnlvv
    ahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkftyeemkkr
    ivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavlkgevdfiv
    ltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekpknyseesr
    rwrerydsyld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x9jC (C:)
    mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
    tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
    gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkryeemnlvv
    ahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkftyeemkkr
    ivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavlkgevdfiv
    ltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekpknyseesr
    rwrerydsyldgilr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9jC (C:)
    mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
    tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
    gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkryeemnlvv
    ahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkftyeemkkr
    ivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavlkgevdfiv
    ltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekpknyseesr
    rwrerydsyld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1x9jD (D:)
    mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
    tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
    gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkryeemnlvv
    ahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkftyeemkkr
    ivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavlkgevdfiv
    ltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekpknyseesr
    rwrerydsyldgilr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9jD (D:)
    mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
    tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
    gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkryeemnlvv
    ahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkftyeemkkr
    ivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavlkgevdfiv
    ltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekpknyseesr
    rwrerydsyldgi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1x9jE (E:)
    mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
    tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
    gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkryeemnlvv
    ahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkftyeemkkr
    ivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavlkgevdfiv
    ltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekpknyseesr
    rwrerydsyldgilr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9jE (E:)
    mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
    tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
    gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkryeemnlvv
    ahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkftyeemkkr
    ivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavlkgevdfiv
    ltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekpknyseesr
    rwrerydsyld
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1x9jF (F:)
    mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
    tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
    gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkryeemnlvv
    ahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkftyeemkkr
    ivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavlkgevdfiv
    ltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekpknyseesr
    rwrerydsyldgilr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9jF (F:)
    mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
    tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
    gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkryeemnlvv
    ahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkftyeemkkr
    ivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavlkgevdfiv
    ltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekpknyseesr
    rwrerydsyldg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1x9jG (G:)
    mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
    tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
    gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkryeemnlvv
    ahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkftyeemkkr
    ivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavlkgevdfiv
    ltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekpknyseesr
    rwrerydsyldgilr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9jG (G:)
    mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
    tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
    gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkryeemnlvv
    ahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkftyeemkkr
    ivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavlkgevdfiv
    ltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekpknyseesr
    rwrerydsyldgi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1x9jH (H:)
    mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
    tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
    gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkryeemnlvv
    ahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkftyeemkkr
    ivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavlkgevdfiv
    ltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekpknyseesr
    rwrerydsyldgilr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9jH (H:)
    mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
    tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
    gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkryeemnlvv
    ahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkftyeemkkr
    ivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavlkgevdfiv
    ltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekpknyseesr
    rwrerydsyldg