PDB entry 1x9g

View 1x9g on RCSB PDB site
Description: putative mar1 ribonuclease from leishmania donovani
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, Protein structure initiative, SGPP, PSI, Structural Genomics of Pathogenic Protozoa Consortium, UNKNOWN FUNCTION
Deposited on 2004-08-20, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.23
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative mar1
    Species: Leishmania donovani [TaxId:5661]
    Database cross-references and differences (RAF-indexed):
    • PDB 1X9G (Start-199)
    Domains in SCOPe 2.07: d1x9ga1, d1x9ga2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x9gA (A:)
    mahhhhhhmsrlmphyskgktaflcvdlqeafskrienfancvfvanrlarlhevvpent
    kyivtehypkglgrivpeitlpktahliektrfscvvpqveelledvdnavvfgieghac
    ilqtvadlldmnkrvflpkdglgsqkktdfkaaiklmsswgpnceittsesillqmtkda
    mdpnfkriskllkeeppipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9gA (A:)
    msrlmphyskgktaflcvdlqeafskrienfancvfvanrlarlhevvpentkyivtehy
    pkglgrivpeitlpktahliektrfscvvpqveelledvdnavvfgieghacilqtvadl
    ldmnkrvflpkdglgsqkktdfkaaiklmsswgpnceittsesillqmtkdamdpnfkri
    skllkeeppipl