PDB entry 1x9d

View 1x9d on RCSB PDB site
Description: Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue
Class: hydrolase
Keywords: mannosidase, substrate analogue, glycosyl hydrolase, hydrolase
Deposited on 2004-08-20, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
    Species: Homo sapiens [TaxId:9606]
    Gene: MAN1B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x9da_
  • Heterogens: CA, SO4, SMD, BU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x9dA (A:)
    efalltcrldppsqdlkdgtqeeatkrqeapvdprpegdpqrtviswrgaviepeqgtel
    psrraevptkpplppartqgtpvhlnyrqkgvidvflhawkgyrkfawghdelkpvsrsf
    sewfglgltlidaldtmwilglrkefeearkwvskklhfekdvdvnlfestirilgglls
    ayhlsgdslflrkaedfgnrlmpafrtpskipysdvnigtgvahpprwtsdstvaevtsi
    qlefrelsrltgdkkfqeavekvtqhihglsgkkdglvpmfinthsglfthlgvftlgar
    adsyyeyllkqwiqggkqetqlledyveaiegvrthllrhsepskltfvgelahgrfsak
    mdhlvcflpgtlalgvyhglpashmelaqelmetcyqmnrqmetglspeivhfnlypqpg
    rrdvevkpadrhnllrpetveslfylyrvtgdrkyqdwgweilqsfsrftrvpsggyssi
    nnvqdpqkpeprdkmesfflgetlkylfllfsddpnllsldayvfnteahplpiwtpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9dA (A:)
    hlnyrqkgvidvflhawkgyrkfawghdelkpvsrsfsewfglgltlidaldtmwilglr
    kefeearkwvskklhfekdvdvnlfestirilggllsayhlsgdslflrkaedfgnrlmp
    afrtpskipysdvnigtgvahpprwtsdstvaevtsiqlefrelsrltgdkkfqeavekv
    tqhihglsgkkdglvpmfinthsglfthlgvftlgaradsyyeyllkqwiqggkqetqll
    edyveaiegvrthllrhsepskltfvgelahgrfsakmdhlvcflpgtlalgvyhglpas
    hmelaqelmetcyqmnrqmetglspeivhfnlypqpgrrdvevkpadrhnllrpetvesl
    fylyrvtgdrkyqdwgweilqsfsrftrvpsggyssinnvqdpqkpeprdkmesfflget
    lkylfllfsddnllsldayvfnteahplpiwt