PDB entry 1x9b

View 1x9b on RCSB PDB site
Description: Solution NMR Structure of Protein Ta0354 from Thermoplasma acidophilum. Ontario Center for Structural Proteomics target TA0354_69_121; Northeast Structural Genomics Consortium Target TaT38.
Class: structural genomics, unknown function
Keywords: alpha protein, structural genomics, protein structure initiative, PSI, Northeast Structural Genomics Consortium, NESG, Ontario Center for Structural Proteomics, OCSP, UNKNOWN FUNCTION
Deposited on 2004-08-20, released 2004-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical membrane protein ta0354_69_121
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1x9ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x9bA (A:)
    rnlsdrakfesminspsksvfvrnlnelealavrlgksyriqldqakekwkvk