PDB entry 1x9a

View 1x9a on RCSB PDB site
Description: solution nmr structure of protein tm0979 from thermotoga maritima. ontario center for structural proteomics target tm0979_1_87; northeast structural genomics consortium target vt98.
Deposited on 2004-08-20, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1x9aa_
  • Chain 'B':
    Domains in SCOP 1.71: d1x9ab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x9aA (A:)
    mgsshhhhhhssglvprgshmalvlvkygtdhpveklkirsakaedkivliqngvfwale
    eletpakvyaikddflargyseedskvplitysefidllegeekfig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9aA (A:)
    malvlvkygtdhpveklkirsakaedkivliqngvfwaleeletpakvyaikddflargy
    seedskvplitysefidllegeekfig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x9aB (B:)
    mgsshhhhhhssglvprgshmalvlvkygtdhpveklkirsakaedkivliqngvfwale
    eletpakvyaikddflargyseedskvplitysefidllegeekfig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9aB (B:)
    malvlvkygtdhpveklkirsakaedkivliqngvfwaleeletpakvyaikddflargy
    seedskvplitysefidllegeekfig