PDB entry 1x9a

View 1x9a on RCSB PDB site
Description: Solution NMR Structure of Protein Tm0979 from Thermotoga maritima. Ontario Center for Structural Proteomics Target TM0979_1_87; Northeast Structural Genomics Consortium Target VT98.
Class: structural genomics, unknown function
Keywords: structural genomics, protein structure initiative, PSI, Northeast Structural Genomics Consortium, NESG, OCSP, hypothetical protein, beta-alpha protein, dimer, UNKNOWN FUNCTION
Deposited on 2004-08-20, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TM0979
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x9aa_
  • Chain 'B':
    Compound: hypothetical protein TM0979
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x9ab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x9aA (A:)
    mgsshhhhhhssglvprgshmalvlvkygtdhpveklkirsakaedkivliqngvfwale
    eletpakvyaikddflargyseedskvplitysefidllegeekfig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9aA (A:)
    malvlvkygtdhpveklkirsakaedkivliqngvfwaleeletpakvyaikddflargy
    seedskvplitysefidllegeekfig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x9aB (B:)
    mgsshhhhhhssglvprgshmalvlvkygtdhpveklkirsakaedkivliqngvfwale
    eletpakvyaikddflargyseedskvplitysefidllegeekfig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9aB (B:)
    malvlvkygtdhpveklkirsakaedkivliqngvfwaleeletpakvyaikddflargy
    seedskvplitysefidllegeekfig