PDB entry 1x99

View 1x99 on RCSB PDB site
Description: x-ray crystal structure of xerocomus chrysenteron lectin xcl at 1.4 angstroms resolution, mutated at q46m, v54m, l58m
Deposited on 2004-08-20, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.174
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1x99a_
  • Chain 'B':
    Domains in SCOP 1.71: d1x99b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x99A (A:)
    ghmsysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltmggsgtsgmlrfm
    stkgeritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvts
    aigtkvevvytvaegnnleanvifs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x99B (B:)
    ghmsysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltmggsgtsgmlrfm
    stkgeritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvts
    aigtkvevvytvaegnnleanvifs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x99B (B:)
    msysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltmggsgtsgmlrfmst
    kgeritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvtsai
    gtkvevvytvaegnnleanvifs