PDB entry 1x94

View 1x94 on RCSB PDB site
Description: Crystal Structure of a Hypothetical protein
Class: isomerase
Keywords: Hypothetical protein, Vibrio cholerae, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ISOMERASE
Deposited on 2004-08-19, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.229
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative Phosphoheptose isomerase
    Species: Vibrio cholerae [TaxId:666]
    Gene: lpcA, gmhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x94a_
  • Chain 'B':
    Compound: putative Phosphoheptose isomerase
    Species: Vibrio cholerae [TaxId:666]
    Gene: lpcA, gmhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x94b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x94A (A:)
    myqdlirselteaadvlqkflsddhniaqieaaakliadsfkqggkvlscgnggshcdam
    hfaeeltgryrenrpgypgiaisdpshlscvsndfgydyvfsryveavgakgdvlfglst
    sgnsgnilkaieaakakgmktialtgkdggkmagladveirvphfgyadriqevhikiih
    iiiqliekema
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x94A (A:)
    myqdlirselteaadvlqkflsddhniaqieaaakliadsfkqggkvlscgnggshcdam
    hfaeeltgryrenrpgypgiaidyvfsryveavgakgdvlfglstsgnsgnilkaieaak
    akgmktialtgkdggkmagladveirvphfgyadriqevhikiihiiiqliekema
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x94B (B:)
    myqdlirselteaadvlqkflsddhniaqieaaakliadsfkqggkvlscgnggshcdam
    hfaeeltgryrenrpgypgiaisdpshlscvsndfgydyvfsryveavgakgdvlfglst
    sgnsgnilkaieaakakgmktialtgkdggkmagladveirvphfgyadriqevhikiih
    iiiqliekema
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x94B (B:)
    myqdlirselteaadvlqkflsddhniaqieaaakliadsfkqggkvlscgnggshcdam
    hfaeeltgryrenrpgypgiaidyvfsryveavgakgdvlfglstsgnsgnilkaieaak
    akgmktialtgkdggkmagladveirvphfgyadriqevhikiihiiiqliekema