PDB entry 1x93

View 1x93 on RCSB PDB site
Description: NMR Structure of Helicobacter pylori HP0222
Class: transcription
Keywords: HP0222, JHP0208, helicobacter, pylori, transcription, regulator, Arc, MetJ, Mnt, ParG, CopG, RepA
Deposited on 2004-08-19, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein HP0222
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: HP0222
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x93a1
  • Chain 'B':
    Compound: hypothetical protein HP0222
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: HP0222
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x93b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x93A (A:)
    travslyfsdeqyqklekmaneeeesvgsyikryilkalrkiemrgshhhhhhgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x93A (A:)
    travslyfsdeqyqklekmaneeeesvgsyikryilkalrkie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x93B (B:)
    travslyfsdeqyqklekmaneeeesvgsyikryilkalrkiemrgshhhhhhgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x93B (B:)
    travslyfsdeqyqklekmaneeeesvgsyikryilkalrkie