PDB entry 1x92

View 1x92 on RCSB PDB site
Description: crystal structure of pseudomonas aeruginosa phosphoheptose isomerase in complex with reaction product d-glycero-d-mannopyranose-7-phosphate
Class: isomerase
Keywords: MIDWEST CENTRE FOR STRUCTURAL GENOMICS, SIS Domain, a/b protein, lipopolysaccharide biosynthesis, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, isomerase
Deposited on 2004-08-19, released 2004-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoheptose isomerase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: lpcA, gmhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x92a_
  • Chain 'B':
    Compound: Phosphoheptose isomerase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: lpcA, gmhA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HVZ0 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d1x92b1, d1x92b2
  • Heterogens: M7P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x92A (A:)
    ghmdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagda
    qhfssellnrfererpslpavalttdsstitsiandysynevfskqiralgqpgdvllai
    stsgnsanviqaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhl
    laihclcdlidrqlfgsee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x92A (A:)
    dmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagdaqhf
    ssellnrfererpslpavalttdsstitsiandysynevfskqiralgqpgdvllaists
    gnsanviqaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhllai
    hclcdlidrqlfgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x92B (B:)
    ghmdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagda
    qhfssellnrfererpslpavalttdsstitsiandysynevfskqiralgqpgdvllai
    stsgnsanviqaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhl
    laihclcdlidrqlfgsee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x92B (B:)
    ghmdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagda
    qhfssellnrfererpslpavalttdsstitsiandysynevfskqiralgqpgdvllai
    stsgnsanviqaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhl
    laihclcdlidrqlfgs