PDB entry 1x90

View 1x90 on RCSB PDB site
Description: Crystal structure of mutant form B of a pectin methylesterase inhibitor from Arabidopsis
Class: protein binding
Keywords: four-helix bundle, alpha hairpin, disulfide bridge, linker, proline, mutant, PROTEIN BINDING
Deposited on 2004-08-19, released 2004-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: 0.215
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: invertase/pectin methylesterase inhibitor family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT1G48020
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LNF2 (Start-151)
      • engineered (30)
    Domains in SCOPe 2.07: d1x90a_
  • Chain 'B':
    Compound: invertase/pectin methylesterase inhibitor family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT1G48020
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LNF2 (Start-151)
      • engineered (30)
    Domains in SCOPe 2.07: d1x90b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x90A (A:)
    gamssemsticdktlnpsfclkflntkfasanlqalakttldstqaratqtlkklqsiid
    ggvdprsklayrscvdeyesaignleeafehlasgdgmgmnmkvsaaldgadtclddvkr
    lrsvdssvvnnsktiknlcgialvisnmlprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x90A (A:)
    emsticdktlnpsfclkflntkfasanlqalakttldstqaratqtlkklqsiidggvdp
    rsklayrscvdeyesaignleeafehlasgdgmgmnmkvsaaldgadtclddvkrlrsvd
    ssvvnnsktiknlcgialvisnmlprn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x90B (B:)
    gamssemsticdktlnpsfclkflntkfasanlqalakttldstqaratqtlkklqsiid
    ggvdprsklayrscvdeyesaignleeafehlasgdgmgmnmkvsaaldgadtclddvkr
    lrsvdssvvnnsktiknlcgialvisnmlprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x90B (B:)
    emsticdktlnpsfclkflntkfasanlqalakttldstqaratqtlkklqsiidggvdp
    rsklayrscvdeyesaignleeafehlasgdgmgmnmkvsaaldgadtclddvkrlrsvd
    ssvvnnsktiknlcgialvisnmlprn