PDB entry 1x8z

View 1x8z on RCSB PDB site
Description: Crystal structure of a pectin methylesterase inhibitor from Arabidopsis thaliana
Class: protein binding
Keywords: four-helix bundle, alpha hairpin, disulfide bridge, PROTEIN BINDING
Deposited on 2004-08-19, released 2004-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.218
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: invertase/pectin methylesterase inhibitor family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT1G48020
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LNF2 (4-152)
      • cloning artifact (2-3)
    Domains in SCOPe 2.06: d1x8za1, d1x8za2
  • Chain 'B':
    Compound: invertase/pectin methylesterase inhibitor family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT1G48020
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1x8zb_
  • Chain 'C':
    Compound: invertase/pectin methylesterase inhibitor family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT1G48020
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LNF2 (4-152)
      • cloning artifact (3)
    Domains in SCOPe 2.06: d1x8zc1, d1x8zc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x8zA (A:)
    gamdssemsticdktlnpsfclkflntkfaspnlqalakttldstqaratqtlkklqsii
    dggvdprsklayrscvdeyesaignleeafehlasgdgmgmnmkvsaaldgadtclddvk
    rlrsvdssvvnnsktiknlcgialvisnmlprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8zA (A:)
    mdssemsticdktlnpsfclkflntkfaspnlqalakttldstqaratqtlkklqsiidg
    gvdprsklayrscvdeyesaignleeafehlasgdgmgmnmkvsaaldgadtclddvkrl
    rsvdssvvnnsktiknlcgialvisnmlprn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x8zB (B:)
    gamdssemsticdktlnpsfclkflntkfaspnlqalakttldstqaratqtlkklqsii
    dggvdprsklayrscvdeyesaignleeafehlasgdgmgmnmkvsaaldgadtclddvk
    rlrsvdssvvnnsktiknlcgialvisnmlprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8zB (B:)
    semsticdktlnpsfclkflntkfaspnlqalakttldstqaratqtlkklqsiidggvd
    prsklayrscvdeyesaignleeafehlasgdgmgmnmkvsaaldgadtclddvkrlrsv
    dssvvnnsktiknlcgialvisnmlpr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x8zC (C:)
    gamdssemsticdktlnpsfclkflntkfaspnlqalakttldstqaratqtlkklqsii
    dggvdprsklayrscvdeyesaignleeafehlasgdgmgmnmkvsaaldgadtclddvk
    rlrsvdssvvnnsktiknlcgialvisnmlprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8zC (C:)
    dssemsticdktlnpsfclkflntkfaspnlqalakttldstqaratqtlkklqsiidgg
    vdprsklayrscvdeyesaignleeafehlasgdgmgmnmkvsaaldgadtclddvkrlr
    svdssvvnnsktiknlcgialvisnmlprn