PDB entry 1x8x

View 1x8x on RCSB PDB site
Description: Tyrosyl t-RNA Synthetase from E.coli Complexed with Tyrosine
Class: ligase
Keywords: LIGASE, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-08-19, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00951 (1-321)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1x8xa_
  • Heterogens: SO4, TYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x8xA (A:)
    massnlikqlqerglvaqvtdeealaerlaqgpialycgfdptadslhlghlvpllclkr
    fqqaghkpvalvggatgligdpsfkaaerklnteetvqewvdkirkqvapfldfdcgens
    aiaannydwfgnmnvltflrdigkhfsvnqminkeavkqrlnredqgisftefsynllqg
    ydfaclnkqygvvlqiggsdqwgnitsgidltrrlhqnqvfgltvplitkadgtkfgkte
    ggavwldpkktspykfyqfwintadadvyrflkfftfmsieeinaleeedknsgkapraq
    yvlaeqvtrlvhgeeglqaakr