PDB entry 1x8v

View 1x8v on RCSB PDB site
Description: Estriol-bound and ligand-free structures of sterol 14alpha-demethylase (CYP51)
Deposited on 2004-08-18, released 2004-11-23
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-23, with a file datestamp of 2004-11-23.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.206
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1x8va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x8vA (A:)
    msavalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshane
    fffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedq
    vrrmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdpla
    yvdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtpr
    fsadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfha
    lrqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfp
    dphdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefema
    qppesyrndhskmvvqlaqpaavryrrrtgvhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8vA (A:)
    savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
    ffragdddldqakaypfmtpifgrrkemlhnaalrgeqmkghaatiedqvrrmiadwgea
    geidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplayvdpylpiesf
    rrrdearnglvalvadimngrianprdmldvliavkatprfsadeitgmfismmfaghht
    ssgtaswtlielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketlrlhpp
    liilmrvakgefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprqedlln
    rwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvvqlaqp
    aavryrrrt