PDB entry 1x8s
View 1x8s on RCSB PDB site
Description: Structure of the Par-6 PDZ domain with a Pals1 internal ligand
Class: cell cycle
Keywords: cell cycle, par-6
Deposited on
2004-08-18, released
2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: cg5884-pa
Species: Drosophila melanogaster [TaxId:7227]
Gene: Par-6
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1x8sa_ - Chain 'B':
Compound: Pals1 peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1x8sA (A:)
gsethrrvrllkhgsdkplgfyirdgtsvrvtasglekqpgifisrlvpgglaestglla
vndevievngievagktldqvtdmmvanssnliitvkpanqr
Sequence, based on observed residues (ATOM records): (download)
>1x8sA (A:)
ethrrvrllkhgsdkplgfyirdgtsvrvtasglekqpgifisrlvpgglaestgllavn
devievngievagktldqvtdmmvanssnliitvkpan
- Chain 'B':
No sequence available.