PDB entry 1x8o

View 1x8o on RCSB PDB site
Description: 1.01 A Crystal Structure Of Nitrophorin 4 From Rhodnius Prolixus Complexed With Nitric Oxide at pH 5.6
Class: ligand binding protein
Keywords: Lipocalin; beta barrel; heme; nitric oxide, LIGAND BINDING PROTEIN
Deposited on 2004-08-18, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 1.01 Å
R-factor: 0.103
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrophorin 4
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x8oa_
  • Heterogens: PO4, HEM, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x8oA (A:)
    actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
    dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
    tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
    lltk