PDB entry 1x8n

View 1x8n on RCSB PDB site
Description: 1.08 A Crystal Structure Of Nitrophorin 4 From Rhodnius Prolixus Complexed With Nitric Oxide at pH 7.4
Deposited on 2004-08-18, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: 0.136
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1x8na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x8nA (A:)
    actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
    dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
    tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
    lltk