PDB entry 1x8j

View 1x8j on RCSB PDB site
Description: Crystal structure of retinol dehydratase in complex with androsterone and inactive cofactor PAP
Class: transferase
Keywords: sulfotransferase, dehydratase, steroid binding., TRANSFERASE
Deposited on 2004-08-18, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.22
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinol dehydratase
    Species: Spodoptera frugiperda [TaxId:7108]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26490
      • see remark 999 (141)
      • engineered (257)
      • engineered (278)
    Domains in SCOPe 2.07: d1x8ja_
  • Chain 'B':
    Compound: retinol dehydratase
    Species: Spodoptera frugiperda [TaxId:7108]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26490
      • see remark 999 (141)
      • engineered (257)
      • engineered (278)
    Domains in SCOPe 2.07: d1x8jb_
  • Heterogens: CA, A3P, AOI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x8jA (A:)
    mekqqdlpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmp
    lrptdvfvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeey
    ndilpnpenldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkm
    vylardprdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhd
    pnmlflfyedylkdlpgsiariadflgkklseeqiqrlsehlnfekfknngavnmedyre
    igiladgehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnmel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8jA (A:)
    lpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptdv
    fvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilpn
    penldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylard
    prdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlfl
    fyedylkdlpgsiariadflgkklseeqiqrlsehlnfekfknngavnmedyreigilad
    gehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x8jB (B:)
    mekqqdlpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmp
    lrptdvfvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeey
    ndilpnpenldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkm
    vylardprdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhd
    pnmlflfyedylkdlpgsiariadflgkklseeqiqrlsehlnfekfknngavnmedyre
    igiladgehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnmel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8jB (B:)
    lpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptdv
    fvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilpn
    penldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylard
    prdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlfl
    fyedylkdlpgsiariadflgkklseeqiqrlsehlnfekfknngavnmedyreigilad
    gehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnm