PDB entry 1x8i

View 1x8i on RCSB PDB site
Description: Crystal Structure of the Zinc Carbapenemase CphA in Complex with the Antibiotic Biapenem
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-08-18, released 2004-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.153
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: cphA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26918 (0-End)
      • engineered (164)
    Domains in SCOPe 2.07: d1x8ia_
  • Heterogens: ZN, SO4, BMH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x8iA (A:)
    agmsltqvsgpvyvvednyyvqensmvyfgakgvtvvgatwtpdtarelhklikrvsrkp
    vlevintnyhtdraggnaywksigakvvstrqtrdlmksdwaeivaftrkglpeypdlpl
    vlpnvvhdgdftlqegkvrafyagpahtpdgifvyfpdeqvlyggcilkeklgnlsfadv
    kaypqtlerlkamklpiktvigghdsplhgpelidhyealikaapqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8iA (A:)
    agmsltqvsgpvyvvednyyvqensmvyfgakgvtvvgatwtpdtarelhklikrvsrkp
    vlevintnyhtdraggnaywksigakvvstrqtrdlmksdwaeivaftrkglpeypdlpl
    vlpnvvhdgdftlqegkvrafyagpahtpdgifvyfpdeqvlyggcilkeklgnlsfadv
    kaypqtlerlkamklpiktvigghdsplhgpelidhyealikaap