PDB entry 1x8h

View 1x8h on RCSB PDB site
Description: The Mono-Zinc Carbapenemase CphA (N220G mutant) Shows a Zn(II)- NH2 ARG Coordination
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-08-18, released 2004-12-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.154
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: cphA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26918 (0-226)
      • engineered (164)
      • cloning artifact (227)
    Domains in SCOPe 2.05: d1x8ha_
  • Heterogens: ZN, CO3, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x8hA (A:)
    agmsltqvsgpvyvvednyyvqensmvyfgakgvtvvgatwtpdtarelhklikrvsrkp
    vlevintnyhtdraggnaywksigakvvstrqtrdlmksdwaeivaftrkglpeypdlpl
    vlpnvvhdgdftlqegkvrafyagpahtpdgifvyfpdeqvlyggcilkeklgnlsfadv
    kaypqtlerlkamklpiktvigghdsplhgpelidhyealikaapqss