PDB entry 1x8h

View 1x8h on RCSB PDB site
Description: the mono-zinc carbapenemase cpha (n220g mutant) shows a zn(ii)- nh2 arg coordination
Deposited on 2004-08-18, released 2004-12-28
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-28, with a file datestamp of 2004-12-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.154
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1x8ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x8hA (A:)
    agmsltqvsgpvyvvednyyvqensmvyfgakgvtvvgatwtpdtarelhklikrvsrkp
    vlevintnyhtdraggnaywksigakvvstrqtrdlmksdwaeivaftrkglpeypdlpl
    vlpnvvhdgdftlqegkvrafyagpahtpdgifvyfpdeqvlyggcilkeklgnlsfadv
    kaypqtlerlkamklpiktvigghdsplhgpelidhyealikaapqss