PDB entry 1x8g

View 1x8g on RCSB PDB site
Description: Crystal Structure of the Mono-Zinc Carbapenemase CphA from Aeromonas Hydrophyla
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-08-18, released 2004-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: cphA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x8ga_
  • Heterogens: ZN, CO3, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x8gA (A:)
    agmsltqvsgpvyvvednyyvqensmvyfgakgvtvvgatwtpdtarelhklikrvsrkp
    vlevintnyhtdraggnaywksigakvvstrqtrdlmksdwaeivaftrkglpeypdlpl
    vlpnvvhdgdftlqegkvrafyagpahtpdgifvyfpdeqvlygncilkeklgnlsfadv
    kaypqtlerlkamklpiktvigghdsplhgpelidhyealikaapqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8gA (A:)
    agmsltqvsgpvyvvednyyvqensmvyfgakgvtvvgatwtpdtarelhklikrvsrkp
    vlevintnyhtdraggnaywksigakvvstrqtrdlmksdwaeivaftrkglpeypdlpl
    vlpnvvhdgdftlqegkvrafyagpahtpdgifvyfpdeqvlygncilkeklgnlsfadv
    kaypqtlerlkamklpiktvigghdsplhgpelidhyealikaap