PDB entry 1x8e

View 1x8e on RCSB PDB site
Description: Crystal structure of Pyrococcus furiosus phosphoglucose isomerase free enzyme
Class: isomerase
Keywords: cupin superfamily, pyrococcus furiosus, hyperthermophile,phosphoglucose isomerase, extremeophile
Deposited on 2004-08-18, released 2004-10-12
The last revision prior to the SCOP 1.73 freeze date was dated 2004-10-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.218
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-6-phosphate isomerase
    Species: PYROCOCCUS FURIOSUS
    Gene: pgiA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83194 (1-End)
      • initiating methionine (0)
    Domains in SCOP 1.73: d1x8ea_
  • Chain 'B':
    Compound: Glucose-6-phosphate isomerase
    Species: PYROCOCCUS FURIOSUS
    Gene: pgiA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83194 (1-End)
      • initiating methionine (0)
    Domains in SCOP 1.73: d1x8eb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x8eA (A:)
    mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
    eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
    ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
    kvvdnprwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8eA (A:)
    mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
    eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
    ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
    kvvdnprwk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x8eB (B:)
    mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
    eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
    ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
    kvvdnprwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8eB (B:)
    mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
    eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
    ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
    kvvdnprwk