PDB entry 1x8c

View 1x8c on RCSB PDB site
Description: Crystal structure of the SeMet-derivative copper homeostasis protein (cutCm) with calcium binding from Shigella flexneri 2a str. 301
Class: metal binding protein
Keywords: CutC family, Tim-like protein, Metal binding protein, Copper homeostasis
Deposited on 2004-08-18, released 2005-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper homeostasis protein cutC
    Species: Shigella flexneri [TaxId:198214]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67825 (0-247)
      • modified residue (0)
      • modified residue (10)
      • modified residue (102)
      • modified residue (105)
      • modified residue (109)
      • modified residue (125)
      • modified residue (161)
      • modified residue (173)
      • modified residue (206)
      • modified residue (237)
    Domains in SCOPe 2.07: d1x8ca_
  • Chain 'B':
    Compound: Copper homeostasis protein cutC
    Species: Shigella flexneri [TaxId:198214]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67825 (0-247)
      • modified residue (0)
      • modified residue (10)
      • modified residue (102)
      • modified residue (105)
      • modified residue (109)
      • modified residue (125)
      • modified residue (161)
      • modified residue (173)
      • modified residue (206)
      • modified residue (237)
      • expression tag (248-249)
    Domains in SCOPe 2.07: d1x8cb2, d1x8cb3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x8cA (A:)
    malleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirp
    rggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtf
    hrafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvr
    aenlhhfldagvlevhssagawqaspmryrnqglsmssdehadeysryivdgaavaemkg
    iierhqaklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8cA (A:)
    malleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirp
    rggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtf
    hrafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvr
    aenlhhfldagvlevhssagawqaspmryrysryivdgaavaemkgiierhqak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x8cB (B:)
    malleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirp
    rggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtf
    hrafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvr
    aenlhhfldagvlevhssagawqaspmryrnqglsmssdehadeysryivdgaavaemkg
    iierhqaklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8cB (B:)
    malleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirp
    rggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtf
    hrafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvr
    aenlhhfldagvlevhssagawqaspmryrneysryivdgaavaemkgiierhqakle