PDB entry 1x8b

View 1x8b on RCSB PDB site
Description: Structure of human Wee1A kinase: kinase domain complexed with inhibitor PD0407824
Class: transferase
Keywords: kinase, cell cycle, wee1, TRANSFERASE
Deposited on 2004-08-17, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.219
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Wee1-like protein kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x8ba_
  • Heterogens: MG, 824, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x8bA (A:)
    gamgmksryttefhelekigsgefgsvfkcvkrldgciyaikrskkplagsvdeqnalre
    vyahavlgqhshvvryfsawaeddhmliqneycnggsladaisenyrimsyfkeaelkdl
    llqvgrglryihsmslvhmdikpsnifisrtsipnaaseegdeddwasnkvmfkigdlgh
    vtrisspqveegdsrflanevlqenythlpkadifalaltvvcaagaeplprngdqwhei
    rqgrlpripqvlsqeftellkvmihpdperrpsamalvkhsvllsasrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8bA (A:)
    mksryttefhelekigsgefgsvfkcvkrldgciyaikrskkplagsvdeqnalrevyah
    avlgqhshvvryfsawaeddhmliqneycnggsladaisenyrimsyfkeaelkdlllqv
    grglryihsmslvhmdikpsnifiskvmfkigdlghvtrisspqveegdsrflanevlqe
    nythlpkadifalaltvvcaagaeplprngdqwheirqgrlpripqvlsqeftellkvmi
    hpdperrpsamalvkhsvl