PDB entry 1x89

View 1x89 on RCSB PDB site
Description: Crystal structure of Siderocalin (NGAL, Lipocalin 2) complexed with Carboxymycobactin S
Class: antimicrobial protein
Keywords: lipocalin, siderophore, ANTIMICROBIAL PROTEIN
Deposited on 2004-08-17, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN2, NGAL, HNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188
      • engineered (86)
    Domains in SCOPe 2.07: d1x89a_
  • Chain 'B':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN2, NGAL, HNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188
      • engineered (86)
    Domains in SCOPe 2.07: d1x89b_
  • Chain 'C':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN2, NGAL, HNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188
      • engineered (86)
    Domains in SCOPe 2.07: d1x89c_
  • Heterogens: CM1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x89A (A:)
    qdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelke
    dksynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqham
    vffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x89A (A:)
    tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
    ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
    kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x89B (B:)
    qdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelke
    dksynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqham
    vffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x89B (B:)
    tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailrepqkmyatiyelkedksynv
    tsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkkv
    sqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x89C (C:)
    qdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelke
    dksynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqham
    vffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x89C (C:)
    sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
    nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
    kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid