PDB entry 1x88

View 1x88 on RCSB PDB site
Description: Human Eg5 motor domain bound to Mg-ADP and monastrol
Class: cell cycle
Keywords: Switch II, Motor domain, Neck linker, cell cycle
Deposited on 2004-08-17, released 2005-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, KNSL1, EG5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x88a_
  • Chain 'B':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, KNSL1, EG5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x88b_
  • Heterogens: MG, ADP, NAT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x88A (A:)
    kkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfd
    mvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytwee
    dplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddpr
    nkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkett
    idgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphv
    pyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknilnkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x88A (A:)
    niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
    qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
    rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
    gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
    igklnlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsi
    iatispaslnleetlstleyahraknilnkpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x88B (B:)
    kkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfd
    mvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytwee
    dplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddpr
    nkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkett
    idgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphv
    pyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknilnkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x88B (B:)
    kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgast
    kqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagii
    prtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvii
    kgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelv
    kigklnlvdlagseninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsi
    iatispaslnleetlstleyahraknilnkpevn