PDB entry 1x87

View 1x87 on RCSB PDB site
Description: 2.4A X-ray structure of Urocanase protein complexed with NAD
Class: structural genomics
Keywords: structural genomics, PUTATIVE UROCANASE PROTEIN, protein structure initiative, MCSG, PSI, Midwest Center for Structural Genomics
Deposited on 2004-08-17, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Urocanase protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1X87 (Start-550)
    Domains in SCOPe 2.07: d1x87a_
  • Chain 'B':
    Compound: Urocanase protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1X87
    Domains in SCOPe 2.07: d1x87b_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x87A (A:)
    maekrtvrpfagterrakgwiqeaalrmlnnnlhpdvaerpdelivyggigkaarnwecy
    eaivdtllrlendetlliqsgkpvavfrthpdaprvliansnlvpawatwdhfheldkkg
    limygqmtagswiyigsqgivqgtyetfaevarqhfggtlagtitltaglggmggaqpla
    vtmnggvclaievdpariqrridtnyldtmtdsldaalemakqakeekkalsiglvgnaa
    evlprlvetgfvpdvltdqtsahdplngyipagltldeaaelrardpkqyiarakqsiaa
    hvramlamqkqgavtfdygnnirqvakdegvddafsfpgfvpayirplfcegkgpfrwva
    lsgdpediyktdevilrefsdnerlchwirmaqkrikfqglparicwlgygerakfgkii
    ndmvakgelkapivigrdhldsgsvaspnretegmkdgsdaiadwpilnallnavggasw
    vsvhhgggvgmgysihagmvivadgtkeaekrlervlttdpglgvirhadagyelairta
    kekgidmpmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x87A (A:)
    vrpfagterrakgwiqeaalrmlnnnlhpdvkaarnwecyeaivdtllrlendetlliqs
    gkpvavfrthpdaprvliansnlvpawatwdhgswiyigsqgivqgtyetfaevarqhfg
    gtlagtitltaglggmggaqplavtmnggvclaievdpariqrridtnyldtmtdsldaa
    lemakqakeekkalsiglvgnaaevlprlvetgfvpdvltdqtsahdplngyipagltld
    eaaelrardpkqyiarakqsiaahvramlamqkqgavtfdygnnirqvakdegvddafsf
    pgfvpayirplfcegkgpfrwvalsgdpediyktdevilrefsdnerlchwirmaqkrik
    fqglparicwlgygerakfgkiindmvakgelkapivigrdhldaiadwpilnallnavg
    gaswvsvhhgggvgmgysihagmvivadgtkeaekrlervlttdpglgvirhadagyela
    irtakekgidmpmlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x87B (B:)
    maekrtvrpfagterrakgwiqeaalrmlnnnlhpdvaerpdelivyggigkaarnwecy
    eaivdtllrlendetlliqsgkpvavfrthpdaprvliansnlvpawatwdhfheldkkg
    limygqmtagswiyigsqgivqgtyetfaevarqhfggtlagtitltaglggmggaqpla
    vtmnggvclaievdpariqrridtnyldtmtdsldaalemakqakeekkalsiglvgnaa
    evlprlvetgfvpdvltdqtsahdplngyipagltldeaaelrardpkqyiarakqsiaa
    hvramlamqkqgavtfdygnnirqvakdegvddafsfpgfvpayirplfcegkgpfrwva
    lsgdpediyktdevilrefsdnerlchwirmaqkrikfqglparicwlgygerakfgkii
    ndmvakgelkapivigrdhldsgsvaspnretegmkdgsdaiadwpilnallnavggasw
    vsvhhgggvgmgysihagmvivadgtkeaekrlervlttdpglgvirhadagyelairta
    kekgidmpmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x87B (B:)
    agterrakgwiqeaalrmlnnnlhpdvaerpdelkaarnwecyeaivdtllrlendetll
    iqsgkpvavfrthpdaprvliansnagswiyigsqgivqgtyetfaevarqhfggtlagt
    itltaglggmggaqplavtmnggvclaievdpariqrridtnyldtmtdsldaalemakq
    akeekkalsiglvgnaaevlprlvetgfvpdvltdqtsahdplngyipagltldeaaelr
    ardpkqyiarakqsiaahvramlamqkqgavtfdygnnirqvakdegvddafsfpgfvpa
    yirplfcegkgpfrwvalsgdpediyktdevilrefsdnerlchwirmaqkrikfqglpa
    ricwlgygerakfgkiindmvakgelkapivigrdegmkdgsdaiadwpilnallnavgg
    aswvsvhhgggvgmgysihagmvivadgtkeaekrlervlttdpglgvirhadagyelai
    rtakekgidmpml