PDB entry 1x83

View 1x83 on RCSB PDB site
Description: Y104F IPP isomerase reacted with (S)-bromohydrine of IPP
Class: isomerase
Keywords: isomerase, complex
Deposited on 2004-08-17, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.231
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isopentenyl-diphosphate delta-isomerase
    Species: Escherichia coli [TaxId:562]
    Gene: IDI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46822
      • engineered (103)
    Domains in SCOPe 2.07: d1x83a1
  • Chain 'B':
    Compound: Isopentenyl-diphosphate delta-isomerase
    Species: Escherichia coli [TaxId:562]
    Gene: IDI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46822 (Start-181)
      • engineered (103)
      • expression tag (182)
    Domains in SCOPe 2.07: d1x83b2, d1x83b3
  • Heterogens: MN, MG, SBH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x83A (A:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvcghpqlgesnedavirrcryelgveitppesiypdfrfratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x83A (A:)
    ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
    nsvcghpqlgesnedavirrcryelgveitppesiypdfrfratdpsgivenevcpvfaa
    rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x83B (B:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvcghpqlgesnedavirrcryelgveitppesiypdfrfratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x83B (B:)
    ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
    nsvcghpqlgesnedavirrcryelgveitppesiypdfrfratdpsgivenevcpvfaa
    rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlkl