PDB entry 1x82

View 1x82 on RCSB PDB site
Description: crystal structure of phosphoglucose isomerase from pyrococcus furiosus with bound 5-phospho-d-arabinonate
Deposited on 2004-08-17, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.163
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1x82a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x82A (A:)
    mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
    eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
    ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
    kvvdnprwkk