PDB entry 1x7v

View 1x7v on RCSB PDB site
Description: Crystal structure of PA3566 from Pseudomonas aeruginosa
Class: structural genomics, unknown function
Keywords: structural genomics, protein structure initiative, Midwest Center for Structural Genomics, alpha-beta plait, PSI, MCSG, UNKNOWN FUNCTION
Deposited on 2004-08-16, released 2004-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.167
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PA3566 protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY51 (2-98)
      • cloning artifact (1)
      • modified residue (2)
      • modified residue (56)
    Domains in SCOPe 2.08: d1x7va1, d1x7va2
  • Chain 'B':
    Compound: PA3566 protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY51 (2-98)
      • cloning artifact (1)
      • modified residue (2)
      • modified residue (56)
    Domains in SCOPe 2.08: d1x7vb1, d1x7vb2
  • Chain 'C':
    Compound: PA3566 protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY51 (2-98)
      • cloning artifact (0-1)
      • modified residue (2)
      • modified residue (56)
    Domains in SCOPe 2.08: d1x7vc1, d1x7vc2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x7vA (A:)
    ghmstpltliatitaapghaealerelralvapsraeagclqydlhqdrhdshlfymieq
    wrddaalerhqntehflrfsrgneallqnvkidqlyrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7vA (A:)
    hmstpltliatitaapghaealerelralvapsraeagclqydlhqdrhdshlfymieqw
    rddaalerhqntehflrfsrgneallqnvkidqlyrla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x7vB (B:)
    ghmstpltliatitaapghaealerelralvapsraeagclqydlhqdrhdshlfymieq
    wrddaalerhqntehflrfsrgneallqnvkidqlyrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7vB (B:)
    hmstpltliatitaapghaealerelralvapsraeagclqydlhqdrhdshlfymieqw
    rddaalerhqntehflrfsrgneallqnvkidqlyrla
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x7vC (C:)
    ghmstpltliatitaapghaealerelralvapsraeagclqydlhqdrhdshlfymieq
    wrddaalerhqntehflrfsrgneallqnvkidqlyrla