PDB entry 1x7u

View 1x7u on RCSB PDB site
Description: Crystal structure of the S324T of catalase-peroxidase KatG
Class: oxidoreductase
Keywords: catalase-peroxidase, INH resistant variant
Deposited on 2004-08-16, released 2004-12-14
Made obsolete by 5l02 on 2016-08-10

The last revision prior to the SCOP 1.75 freeze date was dated 2004-12-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase-peroxidase protein KatG
    Species: Burkholderia pseudomallei
    Gene: katG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q939D2 (Start-747)
      • engineered (323)
    Domains in SCOP 1.75: d1x7ua1, d1x7ua2
  • Chain 'B':
    Compound: catalase-peroxidase protein KatG
    Species: Burkholderia pseudomallei
    Gene: katG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q939D2 (Start-747)
      • engineered (323)
    Domains in SCOP 1.75: d1x7ub1, d1x7ub2
  • Heterogens: NA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x7uA (A:)
    mpgsdagprrrgvheqrrnrmsneakcpfhqaaqngtsnrdwwpnqldlsilhrhsslsd
    pmgkdfnyaqafekldlaavkrdlhalmttsqdwwpadfghygglfirmawhsagtyrta
    dgrggagegqqrfaplnswpdnanldkarrllwpikqkygraiswadlliltgnvalesm
    gfktfgfaggradtwepedvywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvn
    pegpdgnpdpvaaardirdtfarmamndeetvaliagghtfgkthgagpasnvgaepeaa
    gieaqglgwksayrtgkgadaittglevtwtttptqwshnffenlfgyeweltkspagah
    qwvakgadavipdafdpskkhrptmlttdlslrfdpayekisrrfhenpeqfadafaraw
    fklthrdmgprarylgpevpaevllwqdpipavdhplidaadaaelkakvlasgltvsql
    vstawaaastfrgsdkrggangarirlapqkdweanqpeqlaavletleairtafngaqr
    ggkqvsladlivlagcagveqaaknaghavtvpfapgradasqeqtdvesmavlepvadg
    frnylkgkyrvpaevllvdkaqlltlsapemtvllgglrvlganvgqsrhgvftareqal
    tndffvnlldmgtewkptaadadvfegrdratgelkwtgtrvdlvfgshsqlralaevyg
    sadaqekfvrdfvavwnkvmnldrfdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7uA (A:)
    ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
    wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp
    ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
    pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
    iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaittglevtwtttp
    tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
    dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavd
    hplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwe
    anqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpf
    apgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvl
    lgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratge
    lkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x7uB (B:)
    mpgsdagprrrgvheqrrnrmsneakcpfhqaaqngtsnrdwwpnqldlsilhrhsslsd
    pmgkdfnyaqafekldlaavkrdlhalmttsqdwwpadfghygglfirmawhsagtyrta
    dgrggagegqqrfaplnswpdnanldkarrllwpikqkygraiswadlliltgnvalesm
    gfktfgfaggradtwepedvywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvn
    pegpdgnpdpvaaardirdtfarmamndeetvaliagghtfgkthgagpasnvgaepeaa
    gieaqglgwksayrtgkgadaittglevtwtttptqwshnffenlfgyeweltkspagah
    qwvakgadavipdafdpskkhrptmlttdlslrfdpayekisrrfhenpeqfadafaraw
    fklthrdmgprarylgpevpaevllwqdpipavdhplidaadaaelkakvlasgltvsql
    vstawaaastfrgsdkrggangarirlapqkdweanqpeqlaavletleairtafngaqr
    ggkqvsladlivlagcagveqaaknaghavtvpfapgradasqeqtdvesmavlepvadg
    frnylkgkyrvpaevllvdkaqlltlsapemtvllgglrvlganvgqsrhgvftareqal
    tndffvnlldmgtewkptaadadvfegrdratgelkwtgtrvdlvfgshsqlralaevyg
    sadaqekfvrdfvavwnkvmnldrfdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7uB (B:)
    ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
    wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp
    ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
    pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
    iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaittglevtwtttp
    tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
    dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavd
    hplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwe
    anqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpf
    apgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvl
    lgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratge
    lkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla