PDB entry 1x7u

View 1x7u on RCSB PDB site
Description: crystal structure of the s324t of catalase-peroxidase katg
Deposited on 2004-08-16, released 2004-12-14
Made obsolete by 5l02 on 2016-08-10

The last revision was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase-peroxidase protein KatG
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: katG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q939D2 (Start-747)
      • engineered (323)
  • Chain 'B':
    Compound: catalase-peroxidase protein KatG
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: katG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q939D2 (Start-747)
      • engineered (323)
  • Heterogens: NA, HEM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1x7uA (A:)
    mpgsdagprrrgvheqrrnrmsneakcpfhqaaqngtsnrdwwpnqldlsilhrhsslsd
    pmgkdfnyaqafekldlaavkrdlhalmttsqdwwpadfghygglfirmawhsagtyrta
    dgrggagegqqrfaplnswpdnanldkarrllwpikqkygraiswadlliltgnvalesm
    gfktfgfaggradtwepedvywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvn
    pegpdgnpdpvaaardirdtfarmamndeetvaliagghtfgkthgagpasnvgaepeaa
    gieaqglgwksayrtgkgadaittglevtwtttptqwshnffenlfgyeweltkspagah
    qwvakgadavipdafdpskkhrptmlttdlslrfdpayekisrrfhenpeqfadafaraw
    fklthrdmgprarylgpevpaevllwqdpipavdhplidaadaaelkakvlasgltvsql
    vstawaaastfrgsdkrggangarirlapqkdweanqpeqlaavletleairtafngaqr
    ggkqvsladlivlagcagveqaaknaghavtvpfapgradasqeqtdvesmavlepvadg
    frnylkgkyrvpaevllvdkaqlltlsapemtvllgglrvlganvgqsrhgvftareqal
    tndffvnlldmgtewkptaadadvfegrdratgelkwtgtrvdlvfgshsqlralaevyg
    sadaqekfvrdfvavwnkvmnldrfdla
    

    Sequence, based on observed residues (ATOM records):
    >1x7uA (A:)
    ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
    wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp
    ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
    pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
    iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaittglevtwtttp
    tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
    dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavd
    hplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwe
    anqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpf
    apgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvl
    lgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratge
    lkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1x7uB (B:)
    mpgsdagprrrgvheqrrnrmsneakcpfhqaaqngtsnrdwwpnqldlsilhrhsslsd
    pmgkdfnyaqafekldlaavkrdlhalmttsqdwwpadfghygglfirmawhsagtyrta
    dgrggagegqqrfaplnswpdnanldkarrllwpikqkygraiswadlliltgnvalesm
    gfktfgfaggradtwepedvywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvn
    pegpdgnpdpvaaardirdtfarmamndeetvaliagghtfgkthgagpasnvgaepeaa
    gieaqglgwksayrtgkgadaittglevtwtttptqwshnffenlfgyeweltkspagah
    qwvakgadavipdafdpskkhrptmlttdlslrfdpayekisrrfhenpeqfadafaraw
    fklthrdmgprarylgpevpaevllwqdpipavdhplidaadaaelkakvlasgltvsql
    vstawaaastfrgsdkrggangarirlapqkdweanqpeqlaavletleairtafngaqr
    ggkqvsladlivlagcagveqaaknaghavtvpfapgradasqeqtdvesmavlepvadg
    frnylkgkyrvpaevllvdkaqlltlsapemtvllgglrvlganvgqsrhgvftareqal
    tndffvnlldmgtewkptaadadvfegrdratgelkwtgtrvdlvfgshsqlralaevyg
    sadaqekfvrdfvavwnkvmnldrfdla
    

    Sequence, based on observed residues (ATOM records):
    >1x7uB (B:)
    ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
    wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp
    ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
    pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
    iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaittglevtwtttp
    tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
    dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavd
    hplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwe
    anqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpf
    apgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvl
    lgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratge
    lkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla