PDB entry 1x7t

View 1x7t on RCSB PDB site
Description: Structure of TTR R104H: a non-amyloidogenic variant with protective clinical effects
Class: transport protein
Keywords: Transthyretin, Familial Amyloidotic Polyneuropathy, Amyloid, TRANSPORT PROTEIN
Deposited on 2004-08-16, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.201
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (103)
    Domains in SCOPe 2.07: d1x7ta_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (103)
    Domains in SCOPe 2.07: d1x7tb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x7tA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprhytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7tA (A:)
    kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalispfhehaevvftandsgprhytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x7tB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprhytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7tB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsprhytiaallspysysttavvt