PDB entry 1x7r

View 1x7r on RCSB PDB site
Description: crystal structure of estrogen receptor alpha complexed with genistein
Class: transcription
Keywords: estrogen receptor, estrogen receptor beta, er-beta, er, estrogen receptor alpha, er-alpha, estrogen, nuclear recept transcription factor, agonist
Deposited on 2004-08-16, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor 1 (alpha)
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, NR3A1, ESR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x7ra_
  • Chain 'B':
    Compound: steroid receptor coactivator-3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1X7R
  • Heterogens: GEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x7rA (A:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpvkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
    tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
    dahrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7rA (A:)
    lalsltadqmvsalldaeppilyseseasmmglltnladrelvhminwakrvpgfvdltl
    hdqvhllecawleilmiglvwrsmehpvkllfapnllldrnqgkcvegmveifdmllats
    srfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlihlmak
    agltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldah
    

  • Chain 'B':
    No sequence available.