PDB entry 1x7o

View 1x7o on RCSB PDB site
Description: crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes
Deposited on 2004-08-16, released 2005-01-25
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3699999999999997 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rRNA methyltransferase
    Species: STREPTOMYCES VIRIDOCHROMOGENES [TaxId:1938]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: rRNA methyltransferase
    Species: STREPTOMYCES VIRIDOCHROMOGENES [TaxId:1938]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1x7oA (A:)
    marsrgertpaarritsrnarfqqwqallgnrnkrtrageflvmgvrpislavehgwpvr
    tllydgqrelskwarellrtvrteqiamapdllmelgekneappevvavvempaddldri
    pvredflgvlfdrptspgnigsiirsadalgahglivaghaadvydpksvrsstgslfsl
    pavrvpspgevmdwvearraagtpivlvgtdehgdcdvfdfdftqptlllignetaglsn
    awrtlcdytvsipmagsasslnaanaatailyeavrqrisgrtattp
    

    Sequence, based on observed residues (ATOM records):
    >1x7oA (A:)
    rnarfqqwqallgnrnkrtrageflvmgvrpislavehgwpvrtllydgqrelskwarel
    lrtvrteqiamapdllmelgekneappevvavvempaddldripvredflgvlfdrptsp
    gnigsiirsadalgahglivaghaadvydpksvrsstgslfslpavrvpspgevmdwvea
    rraagtpivlvgtdehgdcdvfdfdftqptlllignetaglsnawrtlcdytvsipmags
    asslnaanaatailyeavrqrisgrta
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1x7oB (B:)
    marsrgertpaarritsrnarfqqwqallgnrnkrtrageflvmgvrpislavehgwpvr
    tllydgqrelskwarellrtvrteqiamapdllmelgekneappevvavvempaddldri
    pvredflgvlfdrptspgnigsiirsadalgahglivaghaadvydpksvrsstgslfsl
    pavrvpspgevmdwvearraagtpivlvgtdehgdcdvfdfdftqptlllignetaglsn
    awrtlcdytvsipmagsasslnaanaatailyeavrqrisgrtattp
    

    Sequence, based on observed residues (ATOM records):
    >1x7oB (B:)
    narfqqwqallgnrnkrtrageflvmgvrpislavehgwpvrtllydglskwarellrtv
    rteqiamapdllmelppevvavvempaddldripvredflgvlfdrptspgnigsiirsa
    dalgahglivaghaadvydpksvrsstgslfslpavrvpspgevmdwvearraagtpivl
    vgtdehgdcdvfdfdftqptlllignetaglsnawrtlcdytvsipmagsasslnaanaa
    tailyeavrqrisgrta