PDB entry 1x7n

View 1x7n on RCSB PDB site
Description: The crystal structure of Pyrococcus furiosus phosphoglucose isomerase with bound 5-phospho-D-arabinonate and Manganese
Class: isomerase
Keywords: CUPIN SUPERFAMILY, PYROCOCCUS FURIOSUS, HYPERTHERMOPHILE, PHOSPHOGLUCOSE ISOMERASE, EXTREMEOPHILE, 5-phospho-D-arabinonate, ISOMERASE
Deposited on 2004-08-16, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.144
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-6-phosphate isomerase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: pgiA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83194 (1-End)
      • initating methionine (0)
    Domains in SCOPe 2.07: d1x7na1, d1x7na2
  • Heterogens: MN, PA5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x7nA (A:)
    mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
    eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
    ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
    kvvdnprwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7nA (A:)
    mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
    eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
    ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
    kvvdnprwk