PDB entry 1x7l

View 1x7l on RCSB PDB site
Description: Solution structure of apo-dr1885 from deinococcus radiodurans
Deposited on 2004-08-16, released 2004-08-31
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-31, with a file datestamp of 2004-08-31.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1x7la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x7lA (A:)
    mghtmpahtppaqtapaaqkagaqalpvtvqgatvaavppsirdtaaymtltnksdqpik
    lvgaatplatspmlmttthsggmagmkmvpwltipargtltlqrdgdhvmlmglkrplkv
    getvnitlkatdgrtlnvaatvkkniegr