PDB entry 1x7l

View 1x7l on RCSB PDB site
Description: Solution structure of apo-dr1885 from deinococcus radiodurans
Deposited on 2004-08-16, released 2004-08-31
The last revision was dated 2007-06-12, with a file datestamp of 2007-06-08.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein DR1885
    Species: Deinococcus radiodurans
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RT80 (1-144)
      • initiating methionine (0)
      • insertion (145-148)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1x7lA (A:)
    mghtmpahtppaqtapaaqkagaqalpvtvqgatvaavppsirdtaaymtltnksdqpik
    lvgaatplatspmlmttthsggmagmkmvpwltipargtltlqrdgdhvmlmglkrplkv
    getvnitlkatdgrtlnvaatvkkniegr