PDB entry 1x7i

View 1x7i on RCSB PDB site
Description: Crystal structure of the native copper homeostasis protein (cutCm) with calcium binding from Shigella flexneri 2a str. 301
Class: metal binding protein
Keywords: cutC family, Tim-like protein, Metal binding protein, Copper homeostasis
Deposited on 2004-08-14, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper homeostasis protein cutC
    Species: Shigella flexneri [TaxId:198214]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x7ia_
  • Chain 'B':
    Compound: Copper homeostasis protein cutC
    Species: Shigella flexneri [TaxId:198214]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67825 (0-247)
      • expression tag (248-249)
    Domains in SCOPe 2.07: d1x7ib2, d1x7ib3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x7iA (A:)
    malleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirp
    rggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtf
    hrafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvr
    aenlhhfldagvlevhssagawqaspmryrnqglsmssdehadeysryivdgaavaemkg
    iierhqaklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7iA (A:)
    malleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirp
    rggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtf
    hrafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvr
    aenlhhfldagvlevhssagawqaspmryrdeysryivdgaavaemkgiierhqak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x7iB (B:)
    malleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirp
    rggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtf
    hrafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvr
    aenlhhfldagvlevhssagawqaspmryrnqglsmssdehadeysryivdgaavaemkg
    iierhqaklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7iB (B:)
    malleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirp
    rggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtf
    hrafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvr
    aenlhhfldagvlevhssagawqaspmryrneysryivdgaavaemkgiierhqakle