PDB entry 1x7h

View 1x7h on RCSB PDB site
Description: Actinorhodin Polyketide Ketoreductase, with NADPH bound
Class: oxidoreductase
Keywords: polyketide, actinorhodin, ketoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase, oxidoreductase
Deposited on 2004-08-13, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative ketoacyl reductase
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: actIII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x7ha_
  • Chain 'B':
    Compound: Putative ketoacyl reductase
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: actIII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x7hb_
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x7hA (A:)
    matqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgr
    tcdvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvetnltgvfr
    vtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgi
    tvnavcpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayli
    gpgaaavtaqalnvcgglgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7hA (A:)
    sevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgrtcdvr
    svpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvetnltgvfrvtkqv
    lkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgitvnav
    cpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayligpgaa
    avtaqalnvcgglgny
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x7hB (B:)
    matqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgr
    tcdvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvetnltgvfr
    vtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgi
    tvnavcpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayli
    gpgaaavtaqalnvcgglgny