PDB entry 1x7g

View 1x7g on RCSB PDB site
Description: Actinorhodin Polyketide Ketoreductase, act KR, with NADP bound
Class: oxidoreductase
Keywords: polyketide, ketoreductase, short chain dehydrogenase/reductase, combinatorial biosynthesis, actinorhodin, antibiotic
Deposited on 2004-08-13, released 2004-12-14
The last revision prior to the SCOP 1.73 freeze date was dated 2004-12-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative ketoacyl reductase
    Species: Streptomyces coelicolor
    Gene: actIII
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x7ga_
  • Chain 'B':
    Compound: Putative ketoacyl reductase
    Species: Streptomyces coelicolor
    Gene: actIII
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x7gb_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x7gA (A:)
    matqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgr
    tcdvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvetnltgvfr
    vtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgi
    tvnavcpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayli
    gpgaaavtaqalnvcgglgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7gA (A:)
    sevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgrtcdvr
    svpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvetnltgvfrvtkqv
    lkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgitvnav
    cpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayligpgaa
    avtaqalnvcgglgny
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x7gB (B:)
    matqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgr
    tcdvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvetnltgvfr
    vtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgi
    tvnavcpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayli
    gpgaaavtaqalnvcgglgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7gB (B:)
    matqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgr
    tcdvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvetnltgvfr
    vtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgi
    tvnavcpgfvetpmaasvrefdritarvpigryvqpsevaemvayligpgaaavtaqaln
    vcgglgny