PDB entry 1x7f

View 1x7f on RCSB PDB site
Description: Crystal structure of an uncharacterized B. cereus protein
Class: Structural Genomics, unknown function
Keywords: Structural Genomics, unknown function, protein structure initiative, outer surface protein, MCSG, PSI, Midwest Center for Structural Genomics
Deposited on 2004-08-13, released 2004-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer surface protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: AAP07802
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x7fa1, d1x7fa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x7fA (A:)
    mhhhhhhssgvdlgtenlyfqsnamerklgislypehstkekdmayisaaarhgfsrift
    cllsvnrpkeeivaefkeiinhakdnnmevildvapavfdqlgisysdlsffaelgadgi
    rldvgfdglteakmtnnpyglkielnvsndiaylenilshqanksaligchnfypqkftg
    lpydyfircserfkkhgirsaafitshvanigpwdindglctleehrnlpievqakhlwa
    tgliddviignayaseeeleklgnlnrymlqlkvhfvdeatevekratlqelhvrrgdit
    eymvrstevrkkykdydfpvresvlqergqvvignnsfgkykgelqiilkempiderkni
    vgtiaeeelflldyvgawtqftcve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7fA (A:)
    merklgislypehstkekdmayisaaarhgfsriftcllsvaefkeiinhakdnnmevil
    dvapavfysdlsffaelgadgirldvgfdglteakmtnnpyglkielnvsndiaylenil
    shqanksaligchnfypqkftglpydyfircserfkkhgirsaafitshvanigpwdind
    glctleehrnlpievqakhlwatgliddviignayaseeeleklgnlnrymlqlkvhfvd
    eatevekratlqelhvrrgditeymvrstevrkkykdydfpvresvlqergqvvignnsf
    gkykgelqiilkempiderknivgtiaeeelflldyvgawtqftcve