PDB entry 1x7d

View 1x7d on RCSB PDB site
Description: Crystal Structure Analysis of Ornithine Cyclodeaminase Complexed with NAD and ornithine to 1.6 Angstroms
Class: lyase
Keywords: Deaminase, Binds NAD+, Binds L-ornithine, binds L-proline, 2 Helix Bundle, Beta Barrel, Rossmann Fold, LYASE
Deposited on 2004-08-13, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.17
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ornithine cyclodeaminase
    Species: Pseudomonas putida [TaxId:303]
    Gene: Ornithine Cyclase (deaminating)
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88H32
      • modified residue (9)
      • modified residue (57)
      • modified residue (85)
      • modified residue (118)
      • modified residue (131)
      • modified residue (214)
      • modified residue (219)
      • modified residue (315)
    Domains in SCOPe 2.07: d1x7da_
  • Chain 'B':
    Compound: ornithine cyclodeaminase
    Species: Pseudomonas putida [TaxId:303]
    Gene: Ornithine Cyclase (deaminating)
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88H32
      • modified residue (9)
      • modified residue (57)
      • modified residue (85)
      • modified residue (118)
      • modified residue (131)
      • modified residue (214)
      • modified residue (219)
      • modified residue (315)
    Domains in SCOPe 2.07: d1x7db_
  • Heterogens: NA, NAD, ORN, MES, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x7dA (A:)
    mtyfidvptmsdlvhdigvapfigelaaalrddfkrwqafdksarvashsevgvielmpv
    adksryafkyvnghpantarnlhtvmafgvladvdsgypvllseltiatalrtaatslma
    aqalarpnarkmaligngaqsefqalafhkhlgieeivaydtdplataklianlkeysgl
    tirrassvaeavkgvdiittvtadkayatiitpdmlepgmhlnavggdcpgktelhadvl
    rnarvfveyepqtriegeiqqlpadfpvvdlwrvlrgetegrqsdsqvtvfdsvgfaled
    ytvlryvlqqaekrgmgtkidlvpwveddpkdlfshtrgragkrrirrva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7dA (A:)
    tyfidvptmsdlvhdigvapfigelaaalrddfkrwqafdksarvashsevgvielmpva
    dksryafkyvnghpantarnlhtvmafgvladvdsgypvllseltiatalrtaatslmaa
    qalarpnarkmaligngaqsefqalafhkhlgieeivaydtdplataklianlkeysglt
    irrassvaeavkgvdiittvtadkayatiitpdmlepgmhlnavggdcpgktelhadvlr
    narvfveyepqtriegeiqqlpadfpvvdlwrvlrgetegrqsdsqvtvfdsvgfaledy
    tvlryvlqqaekrgmgtkidlvpwveddpkdlfshtrgra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x7dB (B:)
    mtyfidvptmsdlvhdigvapfigelaaalrddfkrwqafdksarvashsevgvielmpv
    adksryafkyvnghpantarnlhtvmafgvladvdsgypvllseltiatalrtaatslma
    aqalarpnarkmaligngaqsefqalafhkhlgieeivaydtdplataklianlkeysgl
    tirrassvaeavkgvdiittvtadkayatiitpdmlepgmhlnavggdcpgktelhadvl
    rnarvfveyepqtriegeiqqlpadfpvvdlwrvlrgetegrqsdsqvtvfdsvgfaled
    ytvlryvlqqaekrgmgtkidlvpwveddpkdlfshtrgragkrrirrva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7dB (B:)
    tyfidvptmsdlvhdigvapfigelaaalrddfkrwqafdksarvashsevgvielmpva
    dksryafkyvnghpantarnlhtvmafgvladvdsgypvllseltiatalrtaatslmaa
    qalarpnarkmaligngaqsefqalafhkhlgieeivaydtdplataklianlkeysglt
    irrassvaeavkgvdiittvtadkayatiitpdmlepgmhlnavggdcpgktelhadvlr
    narvfveyepqtriegeiqqlpadfpvvdlwrvlrgetegrqsdsqvtvfdsvgfaledy
    tvlryvlqqaekrgmgtkidlvpwveddpkdlfshtrgr