PDB entry 1x79

View 1x79 on RCSB PDB site
Description: Crystal structure of human GGA1 GAT domain complexed with the GAT-binding domain of Rabaptin5
Class: protein transport
Keywords: Rabaptin5, GGA protein, GAT domain, intracellular trafficking, PROTEIN TRANSPORT
Deposited on 2004-08-13, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor binding protein GGA1
    Species: Homo sapiens [TaxId:9606]
    Gene: GGA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x79a_
  • Chain 'B':
    Compound: Rab GTPase binding effector protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RABEP1, RABPT5, RABPT5A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x79b_
  • Chain 'C':
    Compound: Rab GTPase binding effector protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RABEP1, RABPT5, RABPT5A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x79c_
  • Heterogens: SO4, DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x79A (A:)
    gplgskiskrvnaieevnnnvklltemvmshsqggaaagssedlmkelyqrcermrptlf
    rlasdtedndealaeilqandnltqvinlykqlvrgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x79A (A:)
    iskrvnaieevnnnvklltemvmshsssedlmkelyqrcermrptlfrlasdtedndeal
    aeilqandnltqvinlykqlvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x79B (B:)
    maetrdqvkklqlmlrqandqlektmkdkqeledfikqssedsshqisalvlraqaseil
    leelqqglsqakrdvqeqmavlmqsreqvseelvrlqkdndslqgkhslhvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x79B (B:)
    etrdqvkklqlmlrqandqlektmkdkqeledfikqssedsshqisalvlraqaseille
    elqqglsqakrdvqeqmavlmqsreqvsee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x79C (C:)
    maetrdqvkklqlmlrqandqlektmkdkqeledfikqssedsshqisalvlraqaseil
    leelqqglsqakrdvqeqmavlmqsreqvseelvrlqkdndslqgkhslhvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x79C (C:)
    trdqvkklqlmlrqandqlektmkdkqeledfikqssedsshqisalvlraqaseillee
    lqqglsqakrdvqeqmavlmqsreqvse