PDB entry 1x75

View 1x75 on RCSB PDB site
Description: CcdB:GyrA14 complex
Class: isomerase/signaling protein
Keywords: gyrase, CcdB, topoisomerase, plasmid addiction, TA system, bacterial cell death
Deposited on 2004-08-13, released 2005-05-17
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit A
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA gyrase subunit A
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Cytotoxic protein ccdB
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x75c1
  • Chain 'D':
    Compound: Cytotoxic protein ccdB
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x75d1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x75C (C:)
    mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
    wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x75C (C:)
    mqfkvytyksryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdeswr
    mmttdmasvpvsvigeevadlshrendiknainlmfwgi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1x75D (D:)
    mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
    wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x75D (D:)
    mqfkvytykrerlfvdvqsdiidtpgrrmviplasarllssrelypvvhigdeswrmmtt
    dmasvpvsvigeevadlshrendiknainlmfwgi