PDB entry 1x6v

View 1x6v on RCSB PDB site
Description: The crystal structure of human 3'-phosphoadenosine-5'-phosphosulfate synthetase 1
Class: transferase
Keywords: transferase, ATP sulfurylase, APS kinase, PAPS, phosphoadenosine phosphosulfate
Deposited on 2004-08-12, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS1, PAPSS, ATPSK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43252 (Start-623)
      • conflict (415)
      • expression tag (627-629)
    Domains in SCOPe 2.07: d1x6va1, d1x6va2, d1x6va3, d1x6va4
  • Chain 'B':
    Compound: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS1, PAPSS, ATPSK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43252
      • conflict (415)
    Domains in SCOPe 2.07: d1x6vb1, d1x6vb2, d1x6vb3
  • Heterogens: CL, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x6vA (A:)
    meipgslckkvklsnnaqnwgmqratnvtyqahhvsrnkrgqvvgtrggfrgctvwltgl
    sgagkttvsmaleeylvchgipcytldgdnirqglnknlgfspedreenvrriaevaklf
    adaglvcitsfispytqdrnnarqihegaslpffevfvdaplhvceqrdvkglykkarag
    eikgftgidseyekpeapelvlktdscdvndcvqqvvellqerdivpvdasyevkelyvp
    enklhlaktdaetlpalkinkvdmqwvqvlaegwatplngfmrereylqclhfdclldgg
    vinlsvpivltathedkerldgctafalmyegrrvailrnpeffehrkeercarqwgttc
    knhpyikmvmeqgdwliggdlqvldrvywndgldqyrltptelkqkfkdmnadavsafql
    rnpvhnghallmqdthkqllergyrrpvlllhplggwtkdddvplmwrmkqhaavleegv
    lnpettvvaifpspmmyagptevqwhcrarmvaganfyivgrdpagmphpetgkdlyeps
    hgakvltmapglitleivpfrvaaynkkkkrmdyydsehhedfefisgtrmrklaregqk
    ppegfmapkawtvlteyykslekahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x6vA (A:)
    hvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipcytldgdnirq
    glnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqihegaslpf
    fevfvdaeyekpeapelvlktdscdvndcvqqvvellqerdivpvdasyevkelyvpenk
    lhlaktdaetlpalkinkvdmqwvqvlaegwatplngfmrereylqclhfdclldggvin
    lsvpivltathedkerldgctafalmyegrrvailrnpeffehrkeercarqwgttcknh
    pyikmvmeqgdwliggdlqvldrvywndgldqyrltptelkqkfkdmnadavsafqlrnp
    vhnghallmqdthkqllergyrrpvlllhplggwtkdddvplmwrmkqhaavleegvlnp
    ettvvaifpspmmyagptevqwhcrarmvaganfyivgrdpagmphpetgkdlyepshga
    kvltmapglitleivpfrvaaynkkkkrmdyydsehhedfefisgtrmrklaregqkppe
    gfmapkawtvlteyykslekahhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x6vB (B:)
    meipgslckkvklsnnaqnwgmqratnvtyqahhvsrnkrgqvvgtrggfrgctvwltgl
    sgagkttvsmaleeylvchgipcytldgdnirqglnknlgfspedreenvrriaevaklf
    adaglvcitsfispytqdrnnarqihegaslpffevfvdaplhvceqrdvkglykkarag
    eikgftgidseyekpeapelvlktdscdvndcvqqvvellqerdivpvdasyevkelyvp
    enklhlaktdaetlpalkinkvdmqwvqvlaegwatplngfmrereylqclhfdclldgg
    vinlsvpivltathedkerldgctafalmyegrrvailrnpeffehrkeercarqwgttc
    knhpyikmvmeqgdwliggdlqvldrvywndgldqyrltptelkqkfkdmnadavsafql
    rnpvhnghallmqdthkqllergyrrpvlllhplggwtkdddvplmwrmkqhaavleegv
    lnpettvvaifpspmmyagptevqwhcrarmvaganfyivgrdpagmphpetgkdlyeps
    hgakvltmapglitleivpfrvaaynkkkkrmdyydsehhedfefisgtrmrklaregqk
    ppegfmapkawtvlteyykslekahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x6vB (B:)
    hvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipcytldgdnirq
    glnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqihegaslpf
    fevfvdaplhvceqrdvkglykkaragftgidseyekpeapelvlktdscdvndcvqqvv
    ellqerdivpvdasyevkelyvpenklhlaktdaetlpalkinkvdmqwvqvlaegwatp
    lngfmrereylqclhfdclldggvinlsvpivltathedkerldgctafalmyegrrvai
    lrnpeffehrkeercarqwgttcknhpyikmvmeqgdwliggdlqvldrvywndgldqyr
    ltptelkqkfkdmnadavsafqlrnpvhnghallmqdthkqllergyrrpvlllhplggw
    tkdddvplmwrmkqhaavleegvlnpettvvaifpspmmyagptevqwhcrarmvaganf
    yivgrdpagmphpetgkdlyepshgakvltmapglitleivpfrvaaynkkkkrmdyyds
    ehhedfefisgtrmrklaregqkppegfmapkawtvlteyykslek