PDB entry 1x6r

View 1x6r on RCSB PDB site
Description: Structure 5: room temperature crystal structure of the truncated pak pilin from Pseudomonas aeruginosa at 1.80A resolution
Class: structural protein
Keywords: type IV pilin, lectin, adhesin, structural protein
Deposited on 2004-08-11, released 2005-04-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.151
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fimbrial protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PILA, FIMA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02973 (7-122)
      • cloning artifact (3-6)
    Domains in SCOPe 2.06: d1x6ra2, d1x6ra3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x6rA (A:)
    alegtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadank
    lgtialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkg
    csr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x6rA (A:)
    gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt
    ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr